PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G19250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 260aa    MW: 28905.7 Da    PI: 6.2938
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G19250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM112.64.2e-3541261128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppG+rF Pt+eelv++yL++k++g +   ++e+vi+ +d ++          +++ + w++F++r++++a+g r++r+t sgyWka g+   v
  OGLUM05G19250.1   4 LPPGYRFYPTEEELVCFYLRHKLDGGRrvPDIERVIPVADAHQ---GA----WTGDGEPWFYFCPRQEREARGGRPSRTTPSGYWKAAGTPGWV 90 
                      79***********************995444444455544443...33....3457789*********************************** PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +s++g+ +g+kkt+vfy+grap g kt+W m+eyr+
  OGLUM05G19250.1  91 YSSDGRPIGTKKTMVFYRGRAPAGAKTKWKMNEYRA 126
                      **********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-423158IPR003441NAC domain
PROSITE profilePS5100540.0684159IPR003441NAC domain
PfamPF023653.6E-245125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGELPPGYRF YPTEEELVCF YLRHKLDGGR RVPDIERVIP VADAHQGAWT GDGEPWFYFC  60
PRQEREARGG RPSRTTPSGY WKAAGTPGWV YSSDGRPIGT KKTMVFYRGR APAGAKTKWK  120
MNEYRAFEED DDNAAAAAPA QNHYLQTRSD FSLCRLYTRS GCPRQFDRRP PSSSVASGGG  180
ENRAAPSSTA AAFANEDAAE SSGKSQKRKR SAPDDRLDST SSSDDNGGCD GSMLQQRQRG  240
TDEELVECSM TDWADLLDWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-28415917165NAC domain-containing protein 19
4dul_A8e-28415917165NAC domain-containing protein 19
1ut7_B8e-28415917165NO APICAL MERISTEM PROTEIN
1ut7_A8e-28415917165NO APICAL MERISTEM PROTEIN
1ut4_B8e-28415917165NO APICAL MERISTEM PROTEIN
1ut4_A8e-28415917165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0637030.0AK063703.1 Oryza sativa Japonica Group cDNA clone:001-119-G11, full insert sequence.
GenBankJN1854420.0JN185442.1 Oryza sativa Japonica Group NAC transcription factor 12 (NAC12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638341.11e-158PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR33e-59NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D9ZZV20.0A0A0D9ZZV2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA017962-PA1e-168(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.19e-59NAC domain containing protein 90